Protein Info for SO_4565 in Shewanella oneidensis MR-1

Annotation: inner membrane protein YjeH (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details amino acids 344 to 364 (21 residues), see Phobius details amino acids 374 to 408 (35 residues), see Phobius details PF13520: AA_permease_2" amino acids 12 to 406 (395 residues), 94.6 bits, see alignment E=6.4e-31 PF00324: AA_permease" amino acids 25 to 400 (376 residues), 92.2 bits, see alignment E=3.2e-30

Best Hits

KEGG orthology group: K03294, basic amino acid/polyamine antiporter, APA family (inferred from 100% identity to son:SO_4565)

Predicted SEED Role

"putative transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8U1 at UniProt or InterPro

Protein Sequence (426 amino acids)

>SO_4565 inner membrane protein YjeH (RefSeq) (Shewanella oneidensis MR-1)
MNSHSGTHGGTIGRWQGAGLMATTLLGTGVFILPQMTIAKAHAGALIAWSLLTLAIIPVA
LIFGRLASVFPHAAGPAYFVEKAFGRTAGRTIGLIFLLVVPMGAPAAILMTFQFVNALIP
LDGWFKVSAEVLVIFGLFLLNLRGIQVSAKLQFGLTLCIVAIVVVLFGASSLQPGHLTSL
ASYGTPEISTMMIAAGIAFWSFLGIEAMTHLADDFRRPQQDMIPAMMMGTVLVGIIYVAC
TLILLLVPTDNSVAMIGVFDALLGGYGAQVIGVLGIASGLATVNVYAASAARLVWSFSCE
GILPRCFAVKNRHGVPIRALGALLSVMASVIVLTHITGQELEHLIAWSNGVFVVIYLMAM
LAAAKLLPRHNLPLVVLGCGFCLALGIALGASMAYVLVLILFVAPFLWWQKTHISRKQTL
VDNKVS