Protein Info for SO_4523 in Shewanella oneidensis MR-1

Name: irgA
Annotation: enterobactin receptor protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 663 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF07715: Plug" amino acids 50 to 160 (111 residues), 93.6 bits, see alignment E=1.6e-30 PF00593: TonB_dep_Rec_b-barrel" amino acids 194 to 635 (442 residues), 211.7 bits, see alignment E=5.6e-66 PF14905: OMP_b-brl_3" amino acids 452 to 656 (205 residues), 42.6 bits, see alignment E=6.7e-15

Best Hits

Swiss-Prot: 52% identical to IRGA_VIBCH: Iron-regulated outer membrane virulence protein (irgA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to son:SO_4523)

Predicted SEED Role

"TonB-dependent receptor; Outer membrane receptor for ferrienterochelin and colicins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8X7 at UniProt or InterPro

Protein Sequence (663 amino acids)

>SO_4523 enterobactin receptor protein (RefSeq) (Shewanella oneidensis MR-1)
MLLRRKKILAQVVSAALLLPATYAFAEAAPDKDKIMERIVVTASGFEQQVRDAPASISVI
TREDLDTRFYRDLTDAMLAVPGVVVTGGADRRDISLRGMGSQYTLILVDGKRQSSRETRT
NSDGPGVEGAWTPPLAAIDRIEIVRGPMSSLYGSDAIGGVINIITRKVPNEWQGELRLDT
TLQEKSVSGNVYQGNFFVNGGLIKDLLGVQLYGQYTQREEDNIYGGYRGRDADNLTARFA
LTPNQDHDIMLEVGTANQELDSTLGKTVAPLAPGASCGRGGCPASSTTEYENSTISLSHT
GRWDFGTSDTYIKHEVYDNKSRKMKIKNTDAQTSVIATLGESHTATFGAAFNYQDLTDET
GNQVSDLQDISRRQWSVFSEDEWRIVDDFALTLGLRLDDDENFGEHLSPRIYGVWGLTGS
TTLKGGISTGFRAPSLRQTVPDWGQVSRGGNMYGNPDLQPETSVNYELGIYTDLTDSITT
SAGVFYNEFKDKITRVACPATQCTDGPNQFGSDPTTYVNIDEAVTQGVELSIDYKILSNL
ALTGNYTYTDSEQKTGAYKGSPLNQLPKHLIQLSVNYEPIDNLNTWLRVNYRGEESQPTT
GPSSRSLIAPSYTLLDLGANYRVNDSIKFSAGIYNAFDKEITQEEYGYIEDGRRYWLGMT
YSF