Protein Info for SO4515 in Shewanella oneidensis MR-1

Annotation: formate dehydrogenase, C subunit, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 76 to 98 (23 residues), see Phobius details amino acids 122 to 147 (26 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 199 to 214 (16 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 261 to 285 (25 residues), see Phobius details TIGR01583: formate dehydrogenase, gamma subunit" amino acids 113 to 318 (206 residues), 161.2 bits, see alignment E=1.6e-51 PF01292: Ni_hydr_CYTB" amino acids 115 to 296 (182 residues), 78.1 bits, see alignment E=3.8e-26

Best Hits

KEGG orthology group: K00127, formate dehydrogenase, gamma subunit [EC: 1.2.1.2] (inferred from 100% identity to son:SO_4515)

Predicted SEED Role

"Formate dehydrogenase -O, gamma subunit (EC 1.2.1.2)" in subsystem Anaerobic respiratory reductases or Formate hydrogenase (EC 1.2.1.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E8Y5 at UniProt or InterPro

Protein Sequence (327 amino acids)

>SO4515 formate dehydrogenase, C subunit, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MNKWFKHIGLAIALLFSAVCLANGGDGQAIQPQAADAQIWAQLKDGATGYTASQSEFHAQ
PINTYDLRVLELRSDWLAPALMAALFGMIIIFVLFIKVNGISKLHHGFSGKMVYRWSKFD
VSIHWLGAIPCLLLILTGLVLLAGRFFFQPWLGEGFWAGLVYGAKQVHDVMAIPFMIGWA
LMITLWAKNQLPKMYDVKWFMVVGGYINFGPFKGKHPDAGFANAGEKMWFWAFALFGLII
SASGMLLLFPNLFEPSRTLSLIALVLHSVSAIVICAFSIVHIFMATVMSEGGMECMVSGY
CDENWASQHHNLWFDEIKANGTLQYKE