Protein Info for SO4482 in Shewanella oneidensis MR-1

Annotation: hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 41 to 64 (24 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details PF10990: DUF2809" amino acids 35 to 128 (94 residues), 80.8 bits, see alignment E=4.7e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_4482)

Predicted SEED Role

"no significant homology. Putative N-terminal signal sequence and 3 putative transmembrane regions were found by PSORT."

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E913 at UniProt or InterPro

Protein Sequence (140 amino acids)

>SO4482 hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MPVNVFSRQPDRKSFLIYAVLLFVIEVLIARFVPSGFIRGFVGDVLVVMLLFCMARALVP
VVNVKGEPINRLLHTPWLALAVLLFAFAIEFGQYWGLVDKLGLGGNRLARIVIGSHFDPL
DLLAYFVGYLILMGLYWKRN