Protein Info for SO4479 in Shewanella oneidensis MR-1

Annotation: sigma-54 dependent transcriptional regulator (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 616 PF01590: GAF" amino acids 75 to 189 (115 residues), 52.5 bits, see alignment E=2.7e-17 PF00158: Sigma54_activat" amino acids 297 to 460 (164 residues), 216.1 bits, see alignment E=9.2e-68 PF14532: Sigma54_activ_2" amino acids 308 to 465 (158 residues), 64.2 bits, see alignment E=5.6e-21 PF07728: AAA_5" amino acids 316 to 435 (120 residues), 30 bits, see alignment E=1.7e-10 PF02954: HTH_8" amino acids 582 to 612 (31 residues), 38.7 bits, see alignment (E = 2.4e-13)

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_4479)

Predicted SEED Role

"Nitrogen regulation protein NtrC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E916 at UniProt or InterPro

Protein Sequence (616 amino acids)

>SO4479 sigma-54 dependent transcriptional regulator (NCBI ptt file) (Shewanella oneidensis MR-1)
MTAKPHFPTIQPWLADSWQRSIGAGLSEFHAADDLRLSHADLKHKHEQYQQLIELVQSHA
LPLFNQLMAQSNSRLLLSDADGYVLKHWGVSRYSSKLADVALDIGVNWLEQYKGTNAIGT
ALMAKQAVSVVGEQHFIRQNRFMSCTACPIFSPQGEMLGVLDITSEQQRHSQQTLMLVSS
LAQQVETALLCHLPDSHYRIDLAAEPSLLSSGWQGIVIADSEGRIVGCNPMAKQLLSQAK
LGDSLELHLGDSWTRAGGFHRDLALHLHTQALGVTQTKSAKTIQDKPQSQLGVRFRDPLL
ERAWQQANKVITKQIPLLVLGETGVGKEQFVKKLHAQSSRRAQPLVAVNCAALPAELVES
ELFGYQAGAFTGANRSGFIGKIRQAHGGFLFLDEIGEMPQAAQSRLLRVLQEREVVPVGS
NQSVKVDIQIIAATHMDLESLVAQGLFRQDLFYRLNGLQVRLPALRERQDIERIIHKLHR
RHRSGPQTLCTELLGQLMRYDWPGNLRELDNLMQVACLMAEDDEVLARAHLPEHLAKKLV
NKPLAVYERQHVENPQNPRDKDDIGRHSADSLHGAINQNVLQAYRACEGNVSQCAKRLGI
SRNALYRKLKQLGIKD