Protein Info for SO4404 in Shewanella oneidensis MR-1

Annotation: iron-sulfur cluster-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 117 to 146 (30 residues), see Phobius details amino acids 175 to 199 (25 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details amino acids 333 to 354 (22 residues), see Phobius details PF12801: Fer4_5" amino acids 114 to 158 (45 residues), 46.2 bits, see alignment 5.3e-16 amino acids 219 to 256 (38 residues), 26.8 bits, see alignment 6.3e-10 PF13237: Fer4_10" amino acids 267 to 313 (47 residues), 25.9 bits, see alignment 1.2e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_4404)

Predicted SEED Role

"Hypothetical iron-sulfur cluster binding protein YccM" in subsystem trimethylamine N-oxide (TMAO) reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E982 at UniProt or InterPro

Protein Sequence (375 amino acids)

>SO4404 iron-sulfur cluster-binding protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MVTLLLSIGAVAISLYWPLALALLIALPLCLIANKFAPEEFKTEIKINTLREGCQQLLAL
SLFLVAIQYCINAIQLKQGSTPWLMRPDVVDAFLPIAGGIELKAIVTLNLWDQTHPAAAL
MLAAVLLTGLLCKRAFCGWACPLGLAGEYLYALRKRFIKAELAPPAWLDWPLRMLKYLLL
LALFYIVIGMPSESIPYYLQGNYHKIADLKMALFFVTPGLITLACFALILALAAWRRQGF
CRYLCPYGAILGLLSFASPLKIRRNTQHCLIEAKGMKCDKCTRACPANIIVHTKTTVRSD
ECQACMRCVAACPKSAALGLSLKSGHRVSHKGLLVLLLLALFALPLTAYLAGFWHSQTPD
NIRMELIQVIDRVGH