Protein Info for SO4396 in Shewanella oneidensis MR-1

Name: acpD
Annotation: acyl carrier protein phosphodiesterase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF02525: Flavodoxin_2" amino acids 2 to 195 (194 residues), 163.4 bits, see alignment E=5.5e-52 PF03358: FMN_red" amino acids 3 to 169 (167 residues), 56.7 bits, see alignment E=2.2e-19

Best Hits

Swiss-Prot: 100% identical to AZOR_SHEON: FMN-dependent NADH-azoreductase (azoR) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01118, FMN-dependent NADH-azoreductase [EC: 1.7.-.-] (inferred from 100% identity to son:SO_4396)

MetaCyc: 64% identical to FMN dependent NADH:quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
RXN0-5375 [EC: 1.7.1.17]; 1.6.5.- [EC: 1.7.1.17]

Predicted SEED Role

"FMN-dependent NADH-azoreductase"

Isozymes

Compare fitness of predicted isozymes for: 1.7.-.-

Use Curated BLAST to search for 1.7.-.- or 1.7.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E990 at UniProt or InterPro

Protein Sequence (198 amino acids)

>SO4396 acyl carrier protein phosphodiesterase (NCBI ptt file) (Shewanella oneidensis MR-1)
MSKVLVLKSSILGGYSQSALLVDYLIGKWEKQGATITVRDLAGKDVLPMVDGEIASGLRG
GAELTARQQEMLDLSNALVEELKANDTIVITAPMYNFNIPTQLKNWIDFVARAGVTFTYT
ENGPKGLVEGKRAVLITTRGGAHKDGPTDHMVPFLKTFLGFIGITDVDVVYAEALNMGPE
ANQKGISEAKASIDKLAV