Protein Info for SO4393 in Shewanella oneidensis MR-1

Annotation: acetyltransferase, GNAT family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF00583: Acetyltransf_1" amino acids 15 to 129 (115 residues), 56.7 bits, see alignment E=4.3e-19 PF13673: Acetyltransf_10" amino acids 43 to 134 (92 residues), 29.6 bits, see alignment E=9.5e-11 PF13508: Acetyltransf_7" amino acids 45 to 130 (86 residues), 43.6 bits, see alignment E=4.7e-15

Best Hits

Swiss-Prot: 59% identical to YSNE_BACSU: Uncharacterized N-acetyltransferase YsnE (ysnE) from Bacillus subtilis (strain 168)

KEGG orthology group: K03829, putative acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to son:SO_4393)

Predicted SEED Role

"acetyltransferase, GNAT family"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E993 at UniProt or InterPro

Protein Sequence (151 amino acids)

>SO4393 acetyltransferase, GNAT family (NCBI ptt file) (Shewanella oneidensis MR-1)
MKITLDDLKGPEIAALLQEHLDDMRATSPPESVHALDLNGLRQPNIRFWTLWDDRNLAGC
GALKWLDAEHAEIKSMRTAATYKQQGVASQILQHLINDAKAAGVQRLSLETGSMTFFQPA
RSLYAKFGFELCGPFADYVLDPNSVFMTKNI