Protein Info for SO4377 in Shewanella oneidensis MR-1

Annotation: membrane protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 834 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details amino acids 360 to 386 (27 residues), see Phobius details amino acids 393 to 415 (23 residues), see Phobius details amino acids 445 to 466 (22 residues), see Phobius details amino acids 684 to 705 (22 residues), see Phobius details amino acids 711 to 731 (21 residues), see Phobius details amino acids 737 to 759 (23 residues), see Phobius details amino acids 766 to 787 (22 residues), see Phobius details amino acids 793 to 815 (23 residues), see Phobius details PF03176: MMPL" amino acids 235 to 409 (175 residues), 29.1 bits, see alignment E=2.6e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_4377)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9A7 at UniProt or InterPro

Protein Sequence (834 amino acids)

>SO4377 membrane protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MTLKIAARINHTLMQTSIKWRLAIWLSLMLAASLWTLQLWHNGAKVQSDILAMLPHLQQD
TLTARALEQVESTLADQVYLALIAKDETQAIAAATLLIEQLEAQNGAFTDIRSADMQMGE
ALGQYYFPHRFKLLTSEQTDALTHNGLDSLVASATTQLYSAFSYANSQLLTQDPLLLFPA
NLLALAPSSKLSAKQGILLAHPNQGVDNSEGVAAIVMAKGKDSAFNPNAQLIQQAALTQA
LTAVTEQYAGIQVLQAGALFHAIEATNTAKSEISILGLASLLGVVLLVWLAFRSVMPLLL
AIVTISSGLLLAVTFTLSVFGELHLLTLVFGTSLIGIAIDYSFHFYCERLNEQHHSAQAT
VAYIFPTVSLAFITSALAYVGIGLAPFPGMQQVAIFCASGLLGAYLTLVLAYPLLAGSKL
PSGEQPLNLAQAYLARMAQFSNKLVSPWGLSLFTLILAGVCLLGISQLKVDDDIRHLQQS
PVSVTEPEDKLRKLLSGGTDNQFLLVRAPSEEALLQKLESLGPQLDIAIKQQELGNYVSL
SSYLPSKQKQDAAYRLQGEIYQSQLSAVLSSIGLDDSLAPSLSVAYLAAKDSYITPTDFF
ELGLGKQLAPLWLAPLGLAPLEHSTDPTASADNTKLGSDSHGAIVLLGGIEDIAALKARF
AKDPQVQLVDKVADISTLMGHYRLLTLKLLGLALVIALLLFSLSFGLKKATVVVAVPALA
AVLTLAILGLVGSPLSLFHALALILIFGIGIDYSLFFASVEQHGKAVMMAVFMSACSTLL
AFGLLAFSQTQAIHYFGLTLSLGIGFTFVLSPLILTTSQVLTTNKVSIPTRNVI