Protein Info for SO4375 in Shewanella oneidensis MR-1

Annotation: hypothetical 4-hydroxybenzoyl-CoA thioesterase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01643: Acyl-ACP_TE
  • amino acids 8 to 130 (123 residues), 30.4 bits, E=4.3e-11
• PF13279: 4HBT_2
  • amino acids 13 to 125 (113 residues), 57.2 bits, E=3.5e-19
• PF03061: 4HBT
  • amino acids 21 to 88 (68 residues), 28.3 bits, E=2.7e-10

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 100% identity to son:SO_4375)

Predicted SEED Role

"FIG002571: 4-hydroxybenzoyl-CoA thioesterase domain protein"

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

See Q8E9A9 at UniProt or InterPro

Protein Sequence (144 amino acids)

>SO4375 hypothetical 4-hydroxybenzoyl-CoA thioesterase (NCBI ptt file) (Shewanella oneidensis MR-1)
MKALLSIEMDMQVPFHDVDSMGITWHGNYLRYFEVARCKLLDELGYNYRQMRASNYAWPI
IDVQIKYVKPSTFEQHITVRAELVEWENRLKINYQIRDTATGERITKGYTIQAAVDMTSQ
EMCFVTPEVFRSKIAPLLAKVDNE