Protein Info for SO4357 in Shewanella oneidensis MR-1

Name: dmsB-2
Annotation: anaerobic dimethyl sulfoxide reductase, B subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 TIGR02951: dimethylsulfoxide reductase, chain B" amino acids 6 to 167 (162 residues), 267.6 bits, see alignment E=2e-84 PF12800: Fer4_4" amino acids 14 to 27 (14 residues), 14.1 bits, see alignment (E = 2e-05) amino acids 101 to 116 (16 residues), 19.5 bits, see alignment (E = 3.9e-07) PF13247: Fer4_11" amino acids 62 to 157 (96 residues), 94.3 bits, see alignment E=1.8e-30 PF13187: Fer4_9" amino acids 70 to 116 (47 residues), 31.1 bits, see alignment 7.6e-11 PF12838: Fer4_7" amino acids 70 to 117 (48 residues), 32 bits, see alignment 5.5e-11 PF12837: Fer4_6" amino acids 96 to 117 (22 residues), 30 bits, see alignment (E = 1.4e-10) PF00037: Fer4" amino acids 96 to 118 (23 residues), 32.9 bits, see alignment (E = 1.5e-11) PF13237: Fer4_10" amino acids 96 to 150 (55 residues), 26.1 bits, see alignment E=2.7e-09

Best Hits

Swiss-Prot: 55% identical to DMSB_SHIFL: Anaerobic dimethyl sulfoxide reductase chain B (dmsB) from Shigella flexneri

KEGG orthology group: K07307, anaerobic dimethyl sulfoxide reductase subunit B (DMSO reductase iron- sulfur subunit) (inferred from 100% identity to son:SO_4357)

MetaCyc: 55% identical to dimethyl sulfoxide reductase subunit B (Escherichia coli K-12 substr. MG1655)
DIMESULFREDUCT-RXN [EC: 1.8.5.3]

Predicted SEED Role

"Anaerobic dimethyl sulfoxide reductase chain B (EC 1.8.99.-)" in subsystem Anaerobic respiratory reductases (EC 1.8.99.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.8.99.-

Use Curated BLAST to search for 1.8.5.3 or 1.8.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9C7 at UniProt or InterPro

Protein Sequence (205 amino acids)

>SO4357 anaerobic dimethyl sulfoxide reductase, B subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MQEPTQYGFYVDTTKCSGCKTCQVACKDRSDIEVGKQWRRTYEYCGGNWTADGQGAYHQD
VFAYYISISCNHCSNPVCVKACPTGAMYKERSTGLVKVNQDLCIGCESCARACPYDAPQI
DPQRKVMTKCDGCSDRVAKGLKPSCVMSCPQRALDFGLIAELKQQYGNDSDISGLPSSSI
THPNLVLKVHAKSGQRGEIINITEV