Protein Info for SO4335 in Shewanella oneidensis MR-1

Annotation: phosphatidylglycerophosphatase B, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 46 to 70 (25 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 178 to 216 (39 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details PF01569: PAP2" amino acids 84 to 242 (159 residues), 79 bits, see alignment E=1.4e-26

Best Hits

KEGG orthology group: K01096, phosphatidylglycerophosphatase B [EC: 3.1.3.27] (inferred from 100% identity to son:SO_4335)

Predicted SEED Role

"Phosphatidylglycerophosphatase B (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.27

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9E9 at UniProt or InterPro

Protein Sequence (260 amino acids)

>SO4335 phosphatidylglycerophosphatase B, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MTHPAYLLRRLALVWLLLATIPSLLLLTQNQLFPLIDLQSPLATALYWLTTTGTAPYGVV
TVLVVLALAYRYMPKALFINLFLAISLSQVLSLSTSHALKSFFKEPRPNLVYLAEQALPE
EAQLTPDTFYQLAHSDRSRVIAEALTELQTRPSGLTLTPNIKQHWEDEIGYSFPSGHTIF
AVTLVLTASYYLLLAGLPIFTSALLAWGLLMGLSRMLLGMHWPQDVLFSTLLAAIISSLS
IFLVSKIRIFTQAFVKASSQ