Protein Info for SO4324 in Shewanella oneidensis MR-1

Annotation: GGDEF domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 876 PF13185: GAF_2" amino acids 55 to 199 (145 residues), 29.4 bits, see alignment E=1.7e-10 amino acids 267 to 401 (135 residues), 37.2 bits, see alignment E=6.5e-13 PF01590: GAF" amino acids 90 to 196 (107 residues), 24.6 bits, see alignment E=6.3e-09 amino acids 266 to 400 (135 residues), 32.7 bits, see alignment E=2.1e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 450 to 613 (164 residues), 138.1 bits, see alignment E=1.2e-44 PF00990: GGDEF" amino acids 452 to 608 (157 residues), 162.8 bits, see alignment E=1.2e-51 PF00563: EAL" amino acids 630 to 864 (235 residues), 144.4 bits, see alignment E=7.7e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_4324)

Predicted SEED Role

"GAF domain/GGDEF domain/EAL domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9F9 at UniProt or InterPro

Protein Sequence (876 amino acids)

>SO4324 GGDEF domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MFRDEDETTPPRAREVERLKKRLYRLKYLAHKYKRAEVVQNALLELSHIATQVSSLEEFY
LGVHHHLKQLISADNFFIATLDVNSGAISVPFFADEKDAHPSQLYPEQSLSTLLQQGLTG
YVFRTGQTLLCDESKVDELVNAEEIVNLGSPCHLWLGVPIKHEDIVTAVLVVQTYDTNVS
YGDIEVELMTFICHHITGVMERLKHQEQLEQAIQQRTKELSQAYDKLKQEVYERRRAERL
QKSLFEIAELASSGSDNPVFYTQLHNVIRHLIPANNCYIALLNEESTHLTFPFYVSQIEN
QHPGARPLQDGLTEYMLKHKRPLLLDQNDINNLIAAKEIYAKAPTLNHTQTMHQWIGIPL
FIHDEVRGALTIYSFSMTQNYQTKDLELLTFVSQHIGAAIEKKLAAESLRRSYEELEEKV
AARTTALAELNKDLEKEIRQRRNMEAKLVHDAKHDALTGLPNRAMFMERLNHAIKHVRRH
SLEQFALLFIDLDRFKLINDTMGHLEGDRFLIETATRLRSCIRSNDTLARLGGDEFVILL
DTINDMNDARDVAERVIRKISQSYHFGTIEFHSGASIGITISGNKLDTSESMLRNADTAM
YQAKANGKGCYVIFDDSASQQKMQDIAFENDFRQALQADELQLNFLPIVDLQTRQTRSLE
CRLSWEHPQWGSIPQEVLNKLAEQANLQVELDKYAIRLLDKCYHQLLISHGDNLDLHLML
SSQHLKHKHVLRGLKTTLKQTQLPLSQLWLFFNEKALVQETENHISGFELLNKLGVNLGI
SHYGSGHSPLNSLLFLPLKGLKLDANITKQLQDEQHIKLMSAYQKAASTLELQTFVDGLQ
SPEQINIFHALGYRFGQGCALASPFALVETQQLVCA