Protein Info for SO4316 in Shewanella oneidensis MR-1

Annotation: hemY protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details amino acids 23 to 24 (2 residues), see Phobius details transmembrane" amino acids 21 to 22 (2 residues), see Phobius details amino acids 42 to 70 (29 residues), see Phobius details TIGR00540: heme biosynthesis-associated TPR protein" amino acids 4 to 385 (382 residues), 245.4 bits, see alignment E=4.3e-77 PF07219: HemY_N" amino acids 26 to 131 (106 residues), 93.1 bits, see alignment E=5.7e-31

Best Hits

KEGG orthology group: K02498, HemY protein (inferred from 100% identity to son:SO_4316)

Predicted SEED Role

"Uncharacterized protein EC-HemY, likely associated with heme metabolism based on gene clustering with hemC, hemD in Proteobacteria (unrelated to HemY-type PPO in GramPositives)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9G7 at UniProt or InterPro

Protein Sequence (388 amino acids)

>SO4316 hemY protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MIKVLIFFGIILLGLCISPWIVGNTGYVYIAAGDYQLETSLAFGIIMLIVFYALFQVLEW
LVITVINLLLRSRFIPHQWRRRSAKKHTLMGALAIAEEDWPAAERAMIKGADNGELPALN
LLAAARAAQHQNKTAERDQYLARAETQPLAANAVATTRTRYLLKQGEFTLARAELDKLAP
TSKSKAPVLKLALELYRAQQDWEALKLLLPILKKRQILDDIQLNSLSVETHSALLQTASL
KGEDALEQCWQWLSRDERNQSEFLAIYTMGLCRFNRKEQAIKLLSKKLRSSPESALLEVI
PQIVTAHDTDIRKQLLKHEITHENNADYQRCLALLYQQTRDMKEAKTCWQNVCRIAPTKD
SWLSLARIQEQLGEQGHANQSYRQAVTL