Protein Info for SO4313 in Shewanella oneidensis MR-1

Name: hemC
Annotation: porphobilinogen deaminase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 PF01379: Porphobil_deam" amino acids 6 to 213 (208 residues), 288.5 bits, see alignment E=2.8e-90 TIGR00212: hydroxymethylbilane synthase" amino acids 6 to 297 (292 residues), 370.1 bits, see alignment E=3.3e-115 PF03900: Porphobil_deamC" amino acids 227 to 295 (69 residues), 80.6 bits, see alignment E=9e-27

Best Hits

Swiss-Prot: 100% identical to HEM3_SHEON: Porphobilinogen deaminase (hemC) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01749, hydroxymethylbilane synthase [EC: 2.5.1.61] (inferred from 100% identity to son:SO_4313)

MetaCyc: 70% identical to hydroxymethylbilane synthase (Escherichia coli K-12 substr. MG1655)
Hydroxymethylbilane synthase. [EC: 2.5.1.61]

Predicted SEED Role

"Porphobilinogen deaminase (EC 2.5.1.61)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 2.5.1.61)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9H0 at UniProt or InterPro

Protein Sequence (310 amino acids)

>SO4313 porphobilinogen deaminase (NCBI ptt file) (Shewanella oneidensis MR-1)
MSENRIRIATRKSPLAMWQAEFVKAELERIHPGIVVELLPMSTKGDVILDTPLAKVGGKG
LFVKELEVAMLEDQADIAVHSMKDVPVDFPEGLGLEVICEREDPRDAFVSNIYKSISELP
LGATVGTSSLRRQCQLRASRPDLIIKDLRGNVGTRLAKLDNGEYDAIILAAAGLIRLKLS
ERIASFISAEESLPANGQGAVGIECRTNDERVKALLAPLEHLETRYRVIAERAMNTRLEG
GCQVPIGAFAEIDGDEMTLRGLVGNPDGSEIIEGVITGPKTEATQLGVALAEELLSKGAK
SILDAVYAKA