Protein Info for SO4309 in Shewanella oneidensis MR-1

Name: lysA
Annotation: diaminopimelate decarboxylase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01048: diaminopimelate decarboxylase
  • amino acids 7 to 410 (404 residues), 528.6 bits, E=4.3e-163
• PF01168: Ala_racemase_N
  • amino acids 35 to 234 (200 residues), 30.5 bits, E=4.4e-11
• PF02784: Orn_Arg_deC_N
  • amino acids 35 to 280 (246 residues), 244.8 bits, E=1.4e-76
• PF00278: Orn_DAP_Arg_deC
  • amino acids 60 to 368 (309 residues), 92.1 bits, E=3.2e-30

Best Hits

Swiss-Prot: 68% identical to DCDA_VIBCH: Diaminopimelate decarboxylase (lysA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 100% identity to son:SO_4309)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis II (6/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

See Q8E9H4 at UniProt or InterPro

Protein Sequence (414 amino acids)

>SO4309 diaminopimelate decarboxylase (NCBI ptt file) (Shewanella oneidensis MR-1)
MDHFLYQDNTLYAEGCRVNDLAQTYGTPLYIYSRATLERHWHAFNNAVAGHPHLVCYAVK
ANSNLAVLNVLARLGSGFDIVSGGELARVIEAGGDPAKVVFSGVGKTVAEMEQALNLGIY
CFNVESSAELEQLNLVAGRLGKVAPVSLRVNPDVDAGTHPYISTGLKENKFGIAMDEAEA
VFARAHALPHLQVKGVDCHIGSQLTEIQPFLDAMDRMLSLIDRLAEQGIVIEHFDVGGGL
GVTYDDETPPHPDVYAAALLKRLGHRKLKLIFEPGRAIAANAGIFVTEVLYLKENSDKRF
AIVDGAMNDLIRPALYSAWQKIIPVTPRDDQAHVFDIVGPVCETGDFLGKDREFAIAPGD
LLVVRSSGAYGFAMASNYNTRPRAAEVMVDGDKAYLVREREKLPQLWQGEQLLP