Protein Info for SO4306 in Shewanella oneidensis MR-1

Name: xerC
Annotation: integrase/recombinase XerC (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF02899: Phage_int_SAM_1" amino acids 9 to 90 (82 residues), 57.4 bits, see alignment E=1.4e-19 TIGR02224: tyrosine recombinase XerC" amino acids 11 to 295 (285 residues), 358.9 bits, see alignment E=1.1e-111 PF00589: Phage_integrase" amino acids 112 to 281 (170 residues), 164.6 bits, see alignment E=1.9e-52

Best Hits

Swiss-Prot: 100% identical to XERC_SHEON: Tyrosine recombinase XerC (xerC) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03733, integrase/recombinase XerC (inferred from 100% identity to son:SO_4306)

Predicted SEED Role

"Tyrosine recombinase XerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7ZAJ5 at UniProt or InterPro

Protein Sequence (299 amino acids)

>SO4306 integrase/recombinase XerC (NCBI ptt file) (Shewanella oneidensis MR-1)
MPARCHSYLQQFEAYMQSERQLSAHTVRNYLYELQRGRELLPEGIDLLNVGREHWQQVLA
KLHRKGLSPRSLSLWLSAVKQWGEFLLRAGAIELNPAKGLSAPKQAKPLPKNIDVDSLTH
LLEIDGNDPLTLRDKAIMELFYSSGLRLAELAALDLSSVQYDQREVRVLGKGNKERIVPV
GRYAIDAISAWLECRRQIPCEDNALFVTEKGKRLSHRSIQARMSKWGQEQALSMRVHPHK
LRHSFATHMLESSADLRAVQELLGHENLSTTQIYTSLDFQHLAKVYDNAHPRAKKQQDK