Protein Info for SO4291 in Shewanella oneidensis MR-1

Name: pstC
Annotation: phosphate ABC transporter, permease protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 60 to 61 (2 residues), see Phobius details amino acids 64 to 98 (35 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 181 to 198 (18 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details amino acids 262 to 284 (23 residues), see Phobius details TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 15 to 287 (273 residues), 284.8 bits, see alignment E=3.3e-89 PF00528: BPD_transp_1" amino acids 91 to 288 (198 residues), 72.4 bits, see alignment E=2.1e-24

Best Hits

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 100% identity to son:SO_4291)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9I6 at UniProt or InterPro

Protein Sequence (290 amino acids)

>SO4291 phosphate ABC transporter, permease protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MPLLLKKSGDLIETSFKILFLCCAMAGVISVSTIGWFVFSEGLPALKEAGVISFVLGKEW
LPPALYGILPMIIASLISTTGAIIIGVPIAIFTAIFLAELAPKWLANLVRPAVELLAGIP
SVVYGFFGLVIIVPGIEAIFDIPAGNTLLAGIIVLAIMILPTIITISETSLRALPSVYKE
GALALGASHIYTIFNVLVPAAKSGILTGVILGVARAIGETMAIIMVMGNAPAMPGSLLEP
ARTLTANIAMEMSYATGIHSSALYATGIVLLAFIVLLNGSLLYLNRKKAY