Protein Info for SO4288 in Shewanella oneidensis MR-1

Annotation: exopolysaccharide synthesis protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 132 to 170 (39 residues), see Phobius details amino acids 177 to 200 (24 residues), see Phobius details PF06055: ExoD" amino acids 12 to 192 (181 residues), 182.1 bits, see alignment E=3.3e-58

Best Hits

Swiss-Prot: 45% identical to EXOD_RHIME: Protein ExoD (exoD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to son:SO_4288)

Predicted SEED Role

"exopolysaccharide synthesis protein ExoD-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9I9 at UniProt or InterPro

Protein Sequence (210 amino acids)

>SO4288 exopolysaccharide synthesis protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MNDLSKDTQLKLSDALQFTSDAIETDHVSLRNLLCLVGEQGMLLFCILLTIPFLLPISIP
GTSTPFGLLIVFIGIGVVLNKGPWLPATLMERHFSSKQIKLVLMKGAALLTRIDHLSRPR
LFLLTSNSTNRCNGILIILVAILLMLPLGAIPFTNTLPAWVILLICIGMLQRDGMFIIWG
YLLAIATLAWFCFLGMGLFVTGQNVSDILR