Protein Info for SO4282 in Shewanella oneidensis MR-1

Name: ktrB
Annotation: potassium uptake protein KtrB (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 87 to 112 (26 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 308 to 339 (32 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 415 to 437 (23 residues), see Phobius details PF02386: TrkH" amino acids 27 to 437 (411 residues), 179.4 bits, see alignment E=5.1e-57 TIGR00933: potassium uptake protein, TrkH family" amino acids 44 to 426 (383 residues), 336.2 bits, see alignment E=1.4e-104

Best Hits

Swiss-Prot: 46% identical to KTRB_BACSU: Ktr system potassium uptake protein B (ktrB) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to son:SO_4282)

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9J5 at UniProt or InterPro

Protein Sequence (454 amino acids)

>SO4282 potassium uptake protein KtrB (NCBI ptt file) (Shewanella oneidensis MR-1)
MVSWHPSVYLAQRTSKAAKNILAAPPLILSISFIFLILIGTLILKLPISTTVPVTWSQSL
FNATSAVTVTGLVVFDVGTVYTTFGQVVIALLIQLGGLGIMTFAIVTLLALGAKIGFLQN
TIAKEAYNSTNTATLVTTAKSVLIFSLCVELIGMIILAVSWSDELGWRTSLFHGFFYTIS
AFNNAGIGLSPDSLMPYVEDPIINLTITALFIIGGLGFTVWIDLWRKKRWDKLTTYSKMM
IIGTISINAIAVLAIYCIEYNNPKTLVPLSETGKWLASWFQAVTPRTAGFNTLAMNELED
ATTAIMLMLMFIGGGSLSTASGIKVVTFMVLILATYGYLRRYDFVYVYHRGISKDTISKA
LALAMISVGTIWASIFFLLLSENASMIDIIFEAVSAFGTVGLSRGLTSNLTVTGQFIIIF
LMFMGRLGPLTLAYFLASPKSKRIRYPETKLTIG