Protein Info for SO4242 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00369: uncharacterized domain 1
  • amino acids 23 to 152 (130 residues), 57.2 bits, E=8.4e-20
• PF03061: 4HBT
  • amino acids 56 to 142 (87 residues), 45.1 bits, E=5e-16

Best Hits

Swiss-Prot: 49% identical to YIGI_ECOL6: Uncharacterized protein YigI (yigI) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 97% identity to shm:Shewmr7_0365)

MetaCyc: 49% identical to acyl-CoA thioesterase YigI (Escherichia coli K-12 substr. MG1655)
Acyl-CoA hydrolase. [EC: 3.1.2.20]; Palmitoyl-CoA hydrolase. [EC: 3.1.2.20, 3.1.2.2]; 3.1.2.2 [EC: 3.1.2.20, 3.1.2.2]

Predicted SEED Role

"putative protein PaaI, possibly involved in aromatic compounds catabolism"

MetaCyc Pathways

• oleate biosynthesis II (animals and fungi) (1/2 steps found)
• palmitoleate biosynthesis IV (fungi and animals) (1/2 steps found)
• stearate biosynthesis I (animals) (1/6 steps found)
• bacterial bioluminescence (1/8 steps found)
• sporopollenin precursors biosynthesis (5/18 steps found)
• cutin biosynthesis (2/16 steps found)
• jasmonic acid biosynthesis (4/19 steps found)
• suberin monomers biosynthesis (3/20 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.2 or 3.1.2.20

Sequence Analysis Tools

See Q8E9M7 at UniProt or InterPro

Protein Sequence (154 amino acids)

>SO4242 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSNPIQAEVLKRVAEVFDQHVPFHNLLGLDIKRYDIDGVEVAINMKPELIGNIHQQILHG
GVTATVLDVVGGLTAFAGLVASRDDWTIEELQQRLQTLGTIDMRVDYLRPGRGQIFTGTG
SVIRAGNRVSVCRMELHNEQGTHIAFGTGTYMVG