Protein Info for SO4235 in Shewanella oneidensis MR-1

Name: leuB
Annotation: 3-isopropylmalate dehydrogenase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00169: 3-isopropylmalate dehydrogenase
  • amino acids 4 to 347 (344 residues), 526 bits, E=2e-162
• PF00180: Iso_dh
  • amino acids 4 to 354 (351 residues), 456 bits, E=4.8e-141

Best Hits

Swiss-Prot: 100% identical to LEU3_SHEON: 3-isopropylmalate dehydrogenase (leuB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00052, 3-isopropylmalate dehydrogenase [EC: 1.1.1.85] (inferred from 100% identity to son:SO_4235)

MetaCyc: 71% identical to 3-isopropylmalate dehydrogenase (Escherichia coli K-12 substr. MG1655)
3-isopropylmalate dehydrogenase. [EC: 1.1.1.85]

Predicted SEED Role

"3-isopropylmalate dehydrogenase (EC 1.1.1.85)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 1.1.1.85)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• L-leucine biosynthesis (6/6 steps found)
• 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
• butanol and isobutanol biosynthesis (engineered) (3/8 steps found)
• aliphatic glucosinolate biosynthesis, side chain elongation cycle (10/30 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Valine, leucine and isoleucine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.85

Sequence Analysis Tools

See Q8E9N3 at UniProt or InterPro

Protein Sequence (364 amino acids)

>SO4235 3-isopropylmalate dehydrogenase (NCBI ptt file) (Shewanella oneidensis MR-1)
MSYQIAVLAGDGIGPEVMAEARKVLKAVEARFGLNIEYTEYDVGGIAIDNHGCPLPEATL
KGCEAADAILFGSVGGPKWEKLPPNEQPERGALLPLRGHFELFCNLRPAKLHDGLEHMSP
LRSDISARGFDVLCVRELTGGIYFGKPKGRQGEGESEEAFDTMRYSRREISRIARIAFEA
ARGRRKKVTSVDKANVLACSVLWRQVVEEVAVDFPDVELEHIYIDNATMQLLRRPDEFDV
MLCSNLFGDILSDEIAMLTGSMGLLSSASMNSTGFGLFEPAGGSAPDIAGKGIANPIAQI
LSAALMLRHSLKQEEAASAIERAVTKALNSGYLTGELLSSDQRHKAKTTVQMGDFIADAV
KAGV