Protein Info for SO4226 in Shewanella oneidensis MR-1

Name: ftsL
Annotation: cell division protein FtsL (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details PF04999: FtsL" amino acids 8 to 102 (95 residues), 134 bits, see alignment E=7.6e-44 TIGR02209: cell division protein FtsL" amino acids 20 to 102 (83 residues), 73.7 bits, see alignment E=4.6e-25

Best Hits

Swiss-Prot: 100% identical to FTSL_SHEON: Cell division protein FtsL (ftsL) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03586, cell division protein FtsL (inferred from 100% identity to son:SO_4226)

Predicted SEED Role

"Cell division protein FtsL" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9P1 at UniProt or InterPro

Protein Sequence (104 amino acids)

>SO4226 cell division protein FtsL (NCBI ptt file) (Shewanella oneidensis MR-1)
MSKPSLTLPRIVLHDLWQHKWILLLALLVLSNAVAVVYTSHVSRKLTTEWDQLLQERDRL
DIEWRNLLLEEQSQTEHSRITRIASKDLNMSRPLPSEEIVVKVP