Protein Info for SO4219 in Shewanella oneidensis MR-1

Name: murG
Annotation: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 TIGR01133: undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase" amino acids 6 to 354 (349 residues), 366.3 bits, see alignment E=7.4e-114 PF03033: Glyco_transf_28" amino acids 8 to 145 (138 residues), 157.6 bits, see alignment E=4.1e-50 PF13579: Glyco_trans_4_4" amino acids 22 to 131 (110 residues), 33.6 bits, see alignment E=9.6e-12 PF13439: Glyco_transf_4" amino acids 22 to 137 (116 residues), 28.9 bits, see alignment E=2.2e-10 PF04101: Glyco_tran_28_C" amino acids 185 to 349 (165 residues), 140.1 bits, see alignment E=1.4e-44

Best Hits

Swiss-Prot: 100% identical to MURG_SHEON: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (murG) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02563, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC: 2.4.1.227] (inferred from 100% identity to son:SO_4219)

Predicted SEED Role

"UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227)" in subsystem Peptidoglycan Biosynthesis (EC 2.4.1.227)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.227

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8CX35 at UniProt or InterPro

Protein Sequence (362 amino acids)

>SO4219 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MTDAGKRILVMAGGTGGHVFPALAVAKYLAQQGWQVRWLGTADRMEARLVPQYGFDIDFI
DIKGVRGNGLVRKLAAPFKVVRSILQAKAVIAEFKPDVVLGMGGFASGPGGVAAKLAGVP
LVLHEQNAIPGMTNKLLSRIASQVLCAFKNTFTQVKAKVVGNPIRRELIALGGEPKQTAD
EALKVLVVGGSLGAKVFNDLMPEVVAALSKQQSITVWHQVGKDNLAGVKSAYQQQGQDGG
VNVAEFIDDMEAAYRWADVVLCRAGALTVSELAAVGLPSILVPYPHAVDDHQTRNAQVLV
EAGAAFLLPQAILDVNKLVSKLQLLANDRAELARMGQRARDVAVLDATEQVAQVCIALAE
KG