Protein Info for SO4211 in Shewanella oneidensis MR-1

Name: secA
Annotation: preprotein translocase, SecA subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 908 PF07517: SecA_DEAD" amino acids 7 to 402 (396 residues), 430.4 bits, see alignment E=1e-132 TIGR00963: preprotein translocase, SecA subunit" amino acids 28 to 816 (789 residues), 1131.2 bits, see alignment E=0 PF00270: DEAD" amino acids 96 to 216 (121 residues), 24.5 bits, see alignment E=6.2e-09 PF01043: SecA_PP_bind" amino acids 232 to 358 (127 residues), 141 bits, see alignment E=6.5e-45 PF21090: P-loop_SecA" amino acids 417 to 615 (199 residues), 314.2 bits, see alignment E=1.1e-97 PF07516: SecA_SW" amino acids 617 to 830 (214 residues), 241.8 bits, see alignment E=2.1e-75 PF02810: SEC-C" amino acids 888 to 906 (19 residues), 38.7 bits, see alignment (E = 2.2e-13)

Best Hits

Swiss-Prot: 76% identical to SECA_AERHH: Protein translocase subunit SecA (secA) from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)

KEGG orthology group: K03070, preprotein translocase subunit SecA (inferred from 76% identity to aha:AHA_3877)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9Q5 at UniProt or InterPro

Protein Sequence (908 amino acids)

>SO4211 preprotein translocase, SecA subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MFGKLLTKVFGSRNDRTLKGLQKVVNKINALEADYEKLTDEQLKAKTAEFRERLAAGASL
DSIMAEAFATVREASKRVFEMRHFDVQLLGGMVLDSNRIAEMRTGEGKTLTATLPAYLNA
LTGKGVHVITVNDYLARRDAENNRPLFEFLGLTVGINVAGLGQQDKKDAYNADITYGTNN
EFGFDYLRDNMAFSPQERVQRPLHYALIDEVDSILIDEARTPLIISGAAEDSSELYIKIN
TLIPNLIRQDKEDSEEYVGEGDYTIDEKAKQVHFTERGQEKVENLLIERGMLAEGDSLYS
AANISLLHHVNAALRAHTLFERDVDYIVQDGEVIIVDEHTGRTMPGRRWSEGLHQAVEAK
EGVRIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAFEFQHIYGLDTVVVPTNRPMVR
KDMADLVYLTANEKYQAIIKDIKDCRERGQPVLVGTVSIEQSELLARLMVKEKIPHQVLN
AKFHEKEAEIVAQAGRTGAVTIATNMAGRGTDIVLGGNWNMEIDALENPTPEQKAKIKAD
WQLRHDAVVAAGGLHILGTERHESRRIDNQLRGRAGRQGDAGSSRFYLSMEDSLMRIFAS
DRVSGMMKKLGMEEGEAIEHPWVSRAIENAQRKVEARNFDIRKQLLEFDDVANDQRQVVY
AQRNELMDAESIADTIQNIQDDVISAVIDQYIPPQSVEELWDVPGLEQRLHQEFMLKLPI
QEWLDKEDDLHEESLRERIITSWSDAYKAKEEMVGASVLRQFEKAVMLQTLDGLWKEHLA
AMDHLRQGIHLRGYAQKNPKQEYKRESFELFQQLLNTLKHDVISVLSKVQVQAQSDVEEM
EARRREEDAKIQRDYQHAAAEALVGGSDEDDAIAAHTPMIRDGDKVGRNDPCPCGSGRKY
KQCHGKLS