Protein Info for SO4190 in Shewanella oneidensis MR-1

Name: ppaC
Annotation: inorganic pyrophosphatase, manganese-dependent (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF01368: DHH" amino acids 3 to 143 (141 residues), 60.9 bits, see alignment E=1.5e-20 PF02833: DHHA2" amino acids 180 to 304 (125 residues), 107.5 bits, see alignment E=6.8e-35

Best Hits

Swiss-Prot: 51% identical to PPAC_ARCFU: Probable manganese-dependent inorganic pyrophosphatase (ppaC) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: K01507, inorganic pyrophosphatase [EC: 3.6.1.1] (inferred from 100% identity to son:SO_4190)

Predicted SEED Role

"Manganese-dependent inorganic pyrophosphatase (EC 3.6.1.1)" in subsystem Phosphate metabolism (EC 3.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9S6 at UniProt or InterPro

Protein Sequence (306 amino acids)

>SO4190 inorganic pyrophosphatase, manganese-dependent (NCBI ptt file) (Shewanella oneidensis MR-1)
MPMYVVGHKIPDSDSICGAIALAYLKNQIGEEAVAARLGELSPETAFILERFGFEAPEYK
TSYAGEQVYIVDHSELTQAPDDIAKATIVGIVDHHKLGDLTTDTPLECWIRPVGCSNTVI
KMMYDFYQVAIPKNIAGIMMCAILSDTVIFKSPTCTTADIRCVEALAEIAGIEDYKALGM
EMFKVKSAVEGTPARDLVMRDFKDFNMNGNLVGIGQLEVIDLSVFDAIKAELEADIKALK
VEGNRHSVLLLLTDIMKEGSELLVVSDDAELINRAYGKTPVDGKVWLDGVLSRKKQVVPQ
LQAAFA