Protein Info for SO4173 in Shewanella oneidensis MR-1

Annotation: sensor histidine kinase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 47 to 64 (18 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 122 to 139 (18 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details PF02518: HATPase_c" amino acids 315 to 416 (102 residues), 39 bits, see alignment E=4.8e-14

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 100% identity to son:SO_4173)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9U0 at UniProt or InterPro

Protein Sequence (428 amino acids)

>SO4173 sensor histidine kinase (NCBI ptt file) (Shewanella oneidensis MR-1)
MMVKILGANLQAADQVALLRTLGLLLQIGLTLFAADTFGLSLQMEPLMHVFVLEVLYLSL
TLALRKPLFAKERGLFIALSLDTLFWISWLYFSGGATNAFISLLLLPIALAAVTLPIWAP
WSLTAISTLAYSVMIFTVPESQMQHHGMDMSSHYLGMWFNFVISALVLTTSVALIAKRMR
RQDAQLAYMREGQLRQEQLVALGTVSAQMAHQLATPLSTLHLLLDELREETPEPSITLVE
METALGRCEHTLAELRLATESIRDRRQRPQNITELVVGLKQKTQLLMPQTALNWLITCEP
KLLEEKQILTDMSLTPAIMALIENAARASVETIGTSQVDISVDCSPSEGQAYLQIRDYGA
GIAPSLLPQLGTLLIESPKGLGVALLLSHASLERLGAELILANHPQGGTVAQIRFTLLAP
KVPTGEIV