Protein Info for SO4163 in Shewanella oneidensis MR-1

Name: hslU
Annotation: heat shock protein HslVU, ATPase subunit HslU (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 TIGR00390: ATP-dependent protease HslVU, ATPase subunit" amino acids 4 to 440 (437 residues), 716.1 bits, see alignment E=8.7e-220 PF07728: AAA_5" amino acids 52 to 88 (37 residues), 25 bits, see alignment 4.1e-09 PF00004: AAA" amino acids 53 to 138 (86 residues), 33.1 bits, see alignment E=1.8e-11 amino acids 234 to 329 (96 residues), 27.9 bits, see alignment E=7.3e-10 PF07724: AAA_2" amino acids 177 to 326 (150 residues), 102.8 bits, see alignment E=5.5e-33

Best Hits

Swiss-Prot: 100% identical to HSLU_SHEON: ATP-dependent protease ATPase subunit HslU (hslU) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03667, ATP-dependent HslUV protease ATP-binding subunit HslU (inferred from 100% identity to son:SO_4163)

MetaCyc: 78% identical to ATPase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent hsl protease ATP-binding subunit HslU" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8E9U9 at UniProt or InterPro

Protein Sequence (440 amino acids)

>SO4163 heat shock protein HslVU, ATPase subunit HslU (NCBI ptt file) (Shewanella oneidensis MR-1)
MSEMTPREIVHELDAHIIGQKKAKRSVAVALRNRWRRMQLDADFRQEVTPKNILMIGPTG
VGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVEQIIRDLTDIAIKLTREQQMGKCR
QRAEEHAEERILDALLPKPKNDWDDSDSNSNTRQIFRKKLRESQLDDKEIDIDVAQPQIG
IEIMSPPGMEEMTNQLQSLFKNMGQAPAKRRKMKIKEAFKLLIEEEAAKLVNQEDLKEQA
IELVEQNGIVFLDEIDKICKRGETSGPDVSREGVQRDLLPLVEGCTVTTKHGMVKTDHIL
FIASGAFQMSKPSDLIPELQGRLPIRVELDALTADDFKRILTEPHASLTEQYIALMATEG
VIIEFTESGIESIAKAAWQVNERTENIGARRLHTVMEKLMEDISYEASDKSGSSFVIDAD
YVSAHLDNLVQDEDLSRFIL