Protein Info for SO4162 in Shewanella oneidensis MR-1

Name: hslV
Annotation: ATP-dependent protease HslV (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03692: ATP-dependent protease HslVU, peptidase subunit
  • amino acids 2 to 172 (171 residues), 286.3 bits, E=3.5e-90
• PF00227: Proteasome
  • amino acids 2 to 166 (165 residues), 89.8 bits, E=9.1e-30

Best Hits

Swiss-Prot: 100% identical to HSLV_SHEON: ATP-dependent protease subunit HslV (hslV) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01419, ATP-dependent HslUV protease, peptidase subunit HslV [EC: 3.4.25.2] (inferred from 98% identity to sbl:Sbal_3867)

MetaCyc: 83% identical to peptidase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent protease HslV (EC 3.4.25.-)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent (EC 3.4.25.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.25.- or 3.4.25.2

Sequence Analysis Tools

See Q8E9V0 at UniProt or InterPro

Protein Sequence (174 amino acids)

>SO4162 ATP-dependent protease HslV (NCBI ptt file) (Shewanella oneidensis MR-1)
MTTIVSVRRNNQVVIAGDGQVSLGNTVMKGNAKKVRRLYHNKVLAGFAGGTADAFTLFER
FESKLEMHQGHLLRSAVELAKDWRTDRMLRKLEAMLVVADAEASLIITGNGDVVQPEHDL
VAIGSGGNYAQAAALALLQNTELSALEIAEKSLTIAGDICVFTNQFKTIEELNY