Protein Info for SO4096 in Shewanella oneidensis MR-1

Name: mreD
Annotation: rod shape-determining protein MreD (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 57 to 89 (33 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details PF04093: MreD" amino acids 7 to 154 (148 residues), 103.8 bits, see alignment E=5.1e-34 TIGR03426: rod shape-determining protein MreD" amino acids 9 to 154 (146 residues), 135.4 bits, see alignment E=7.9e-44

Best Hits

Swiss-Prot: 46% identical to MRED_ECOL6: Rod shape-determining protein MreD (mreD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03571, rod shape-determining protein MreD (inferred from 100% identity to son:SO_4096)

Predicted SEED Role

"Rod shape-determining protein MreD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EA13 at UniProt or InterPro

Protein Sequence (162 amino acids)

>SO4096 rod shape-determining protein MreD (NCBI ptt file) (Shewanella oneidensis MR-1)
MSLQAANGRIVVWLTLFVGLLSQIMPLPTIVEAWRPDWLLMILIYWSIALPHRYNILTAW
VMGLALDILLGATLGVRSLAMSLVIYIAILHCQRLRNFPKWQQSLVVMLLIAIYHLIVYW
VEFVMDGATFHAELFLPALSGLVFWPWIFWILRRIRRHYKVR