Protein Info for SO4053 in Shewanella oneidensis MR-1

Annotation: methyl-accepting chemotaxis protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 634 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details PF14827: dCache_3" amino acids 39 to 268 (230 residues), 150.8 bits, see alignment E=7.5e-48 PF00672: HAMP" amino acids 300 to 353 (54 residues), 56.2 bits, see alignment 5.2e-19 PF00015: MCPsignal" amino acids 417 to 601 (185 residues), 146.9 bits, see alignment E=8.5e-47

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to son:SO_4053)

Predicted SEED Role

"Methyl-accepting chemotaxis protein, homolog 4"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EA56 at UniProt or InterPro

Protein Sequence (634 amino acids)

>SO4053 methyl-accepting chemotaxis protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKNLNISTRIVLGISLLLFAVMSFIMPLVLSEFSRQIRESEQRELHKLYETAVANIVSSG
QRAQAMATLISLTPEIQSNFAERDREALLQRTQPLFMRLKQDFAVQQFQFHTPPATSFLR
LHRPEKFGDDLTAIRKTIVETNTQKQPLSGLEYGVEGLGIRGLVPMNYQGQHTGSVEFGM
SFGQPFFDNFKNAYQAEITLLLPKDGNFVPFGGTFTTDTSASSELNKVMQGTEVIRTIDL
DGKSYALYRHGMQDYSGKTFGVLDIALDRSHSEQAMSDIRFKLIMIGFIAFLIGTAIAWF
IAKSITRPIAETTNALNDIAEGEGDLTRRIEVKSKDEIAQLALAFNRFAEKIHATVAQVS
DSTSLLATSAEEMSAITNETQQMAKRQHLETEQVATAMNEMAATVQEVAHNATDAADAAT
HASESTEHGKLLVEKVISTISLLADEIAHAAKAINELERNTAQIDSVLVVIRNIADQTNL
LALNAAIEAARAGEQGRGFAVVADEVRTLASRTQASTSEIQQMIEALQHSAKSTVSTMNT
STATTQNCVSLVHEAGEALEAITQAVSTISQMNIQIASAANEQCAVSAEINKNVNNINDI
TINATESAVQTARAGDELAQLSMRLTTLLAQFRI