Protein Info for SO4029 in Shewanella oneidensis MR-1

Annotation: transporter, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 13 to 37 (25 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 214 to 237 (24 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 302 to 327 (26 residues), see Phobius details amino acids 340 to 358 (19 residues), see Phobius details amino acids 364 to 386 (23 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 350 (333 residues), 147.4 bits, see alignment E=5.3e-47 PF00083: Sugar_tr" amino acids 48 to 185 (138 residues), 32.4 bits, see alignment E=5e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_4029)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EA80 at UniProt or InterPro

Protein Sequence (455 amino acids)

>SO4029 transporter, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MGNNGLSGTEKKVAFSLASVFGLRMMGLFMIMPVFALYGQHLEGFSPLWVGIAIGAYGLT
QAVLQIPMGILSDKYGRKPVILAGLVVFAIGSVIAANAETIYGVVFGRAVQGMGAIAAAV
LALAADLTRDEQRTKVMAIIGMCIGLSFALSLLMGPIVAQHLGLTGLFWLTALLAILGML
LIQFLVPNPITQAPKGDTLATPAKLKRMFFEPQLFRLNAGIFILHLVLTAVFVALPLDLV
DAGLVKEKHWMLYFPAFVGAFFLMVPLIIIGVKRKNTKAMFQIALVIMMFALAAMAIFAS
NLWVLSVAVLLFFTGFNYLEASLPSLIAKFCPVGEKGSAMGVYSTSQFLGAFCGGMLGGG
AFQLVGAVGVFIVALVLMGIWLLLTLGMKNPVLLKSYTLEAAVKDKNQARDMAAQLSQLM
GVVEAIVVLDEKVAYLKVDEHFDLREARAVLGSAQ