Protein Info for SO3981 in Shewanella oneidensis MR-1

Name: narQ
Annotation: nitrate/nitrite sensor protein NarQ (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 135 to 155 (21 residues), see Phobius details PF13675: PilJ" amino acids 18 to 114 (97 residues), 83.7 bits, see alignment E=1.5e-27 PF07730: HisKA_3" amino acids 351 to 416 (66 residues), 56.5 bits, see alignment E=5.1e-19 PF02518: HATPase_c" amino acids 460 to 578 (119 residues), 33.3 bits, see alignment E=8.5e-12

Best Hits

KEGG orthology group: K07674, two-component system, NarL family, nitrate/nitrite sensor histidine kinase NarQ [EC: 2.7.13.3] (inferred from 100% identity to son:SO_3981)

Predicted SEED Role

"Nitrate/nitrite sensor protein (EC 2.7.3.-)" in subsystem Nitrate and nitrite ammonification (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAC6 at UniProt or InterPro

Protein Sequence (585 amino acids)

>SO3981 nitrate/nitrite sensor protein NarQ (NCBI ptt file) (Shewanella oneidensis MR-1)
MLVLILLSSSLAIFAIINLSYSLGDAKAINASGSLRMQSYRLMFYANSGSEAAQEKITEF
ENTLHSEALHPSKSWLSPKKIAAQYQLVIDKWLVMKYYIEQENSRDYAASLKDFVDTIDL
LVLEMEHHAAFKLRLLAASQIFGLGLMLSIAFLAVRFTKRKVVVPLQQLMESANTISKGN
FEIEMPETEYIELTALTDALQKTARELATLYGNLESQVAEKTLALTRANNELAFLYDTLL
TLNAKKLDYKALKAALNQLKDYESIDYLRLIIQYPEQELEMIEANGGWPESADNSTRFPL
QFEQANLGYLELISAQDINTPLFKNFAIMLTRSIVIHNATEQRQQLALMEERGVIARELH
DSLGQVLSFLKIQISLLRKNLDHSCRSPAVEVQLTEINEGVSTAYVQLRELLSTFRLTIK
EPNLKNAMEAMLEQLRANTDIKIHLDYKLSPQWLEAKQHIHILQITREATLNAIKHANAS
HINIRCYKDDRGMVNISVSDNGVGIGHIKERDQHFGIGIMHERASKLDGEVVFSSNDTHT
NSTATTEQRHQENPDSPLESHNTSNLSQGTIVTLIFPSQQEPTHG