Protein Info for SO3978 in Shewanella oneidensis MR-1

Annotation: hypothetical EAL and a GGDEF domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 2 to 103 (102 residues), 41 bits, see alignment E=8.3e-15 PF00990: GGDEF" amino acids 2 to 103 (102 residues), 53.1 bits, see alignment E=3.3e-18 PF00563: EAL" amino acids 127 to 304 (178 residues), 184.4 bits, see alignment E=2.3e-58

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_3978)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>SO3978 hypothetical EAL and a GGDEF domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MIGDKVLAILGQRLQHNTHNDTFIARMAGAEFVLVQAYQPSEIETNKLINQIINCCHSPV
GIANTLISLHCSIGIAQAPNDGIDAATLLQKAGAAMNISKAEGLAYTHFDQQTQRALSQR
YLLESHLIEALKRNEFSLHYQPIIELNTRNVIGAEALLRWHNPVLGSVTPDQFIPLAERN
GQIMEIGNFVLHSTIQQTANWCNMLQREFKIAINISPIQMRNPRFAEHIAELLTLYQLPA
TALELEITEGMLLQDEHLAHNAIHQLRELGVSISLDDFGTGYSSLSYLQKYAFDTLKIDR
CFIRAC