Protein Info for SO3961 in Shewanella oneidensis MR-1

Name: rpoN
Annotation: RNA polymerase sigma-54 factor (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 PF00309: Sigma54_AID" amino acids 4 to 49 (46 residues), 60.3 bits, see alignment 1.9e-20 TIGR02395: RNA polymerase sigma-54 factor" amino acids 10 to 489 (480 residues), 521.6 bits, see alignment E=9.4e-161 PF04963: Sigma54_CBD" amino acids 131 to 318 (188 residues), 212.7 bits, see alignment E=5.9e-67 PF04552: Sigma54_DBD" amino acids 332 to 489 (158 residues), 231 bits, see alignment E=8.9e-73

Best Hits

Swiss-Prot: 82% identical to RP54_SHEVD: RNA polymerase sigma-54 factor (rpoN) from Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)

KEGG orthology group: K03092, RNA polymerase sigma-54 factor (inferred from 100% identity to son:SO_3961)

MetaCyc: 59% identical to RNA polymerase sigma factor RpoN (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAE5 at UniProt or InterPro

Protein Sequence (491 amino acids)

>SO3961 RNA polymerase sigma-54 factor (NCBI ptt file) (Shewanella oneidensis MR-1)
MKASLQLKLGQQLTMTPQLQQAIRLLQLSSLELQQEIQQALDSNPLLELEEEQFDAPSER
KQDLADTDFSETSAQPQEQDNSTVDIAESLTKESLPEELPMDTTWDEVFTASPNSGSGAS
REDDMPFQGETSEGLYEHLEWQKNLTPFSETDLAIATAIIDAIDDQGYLTQSTEDILEAM
GNPEIELDEVEAVLKRIQHFDPVGVAARDLSECLLIQLSHFSPDTPHLENARMLIKDHLD
LIAARDFRLLMRKTKLKEDELRDSIALIQTLNPRPGLLITAVDEEYVVPDVSVSKKNGRW
VVELNPDCMPKINVNQQYAAMARSSKNQADSQFIRGHLQEAKWFIKSLESRNETLLKVAN
CIVQYQQGFFEYGEEAMKPMVLNDIAEAVEMHESTISRVTTQKYMHTPKGLFELKYFFSS
HVGTDDGGECSSTAIRAFIKKLVAAENQKKPLSDSKMAQLLAEQGINVARRTIAKYREAM
LIPPSNQRKSL