Protein Info for SO3943 in Shewanella oneidensis MR-1

Name: degS
Annotation: protease DegS (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details TIGR02038: periplasmic serine peptidase DegS" amino acids 7 to 357 (351 residues), 598.5 bits, see alignment E=2.1e-184 PF00089: Trypsin" amino acids 86 to 243 (158 residues), 73.3 bits, see alignment E=6.8e-24 PF13365: Trypsin_2" amino acids 87 to 220 (134 residues), 112.7 bits, see alignment E=6.6e-36 PF00595: PDZ" amino acids 260 to 339 (80 residues), 23.8 bits, see alignment E=1.2e-08 PF13180: PDZ_2" amino acids 261 to 350 (90 residues), 45.8 bits, see alignment E=1.5e-15 PF17820: PDZ_6" amino acids 288 to 341 (54 residues), 29.9 bits, see alignment 9.4e-11

Best Hits

Swiss-Prot: 53% identical to DEGS_ECO57: Serine endoprotease DegS (degS) from Escherichia coli O157:H7

KEGG orthology group: K04691, serine protease DegS [EC: 3.4.21.-] (inferred from 100% identity to son:SO_3943)

MetaCyc: 53% identical to serine endoprotease (Escherichia coli K-12 substr. MG1655)
3.4.21.-

Predicted SEED Role

"Outer membrane stress sensor protease DegS" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAF9 at UniProt or InterPro

Protein Sequence (360 amino acids)

>SO3943 protease DegS (NCBI ptt file) (Shewanella oneidensis MR-1)
MTIKDTLLYLGKAVLFGLIMAAMFLLVTHYFDNKSLGNSLLQNRGNNTVELSFAKAVRRA
APAVVNIYSLSIDQSRPLNSGSLQGLGSGVIMSKEGYILTNYHVIKKADEIVVALQDGRK
FTSEVVGFDPETDLSVLKIEGDNLPTVPVNLDSPPQVGDVVLAIGNPYNLGQTITQGIIS
ATGRNGLSSGYLDFLQTDAAINAGNSGGALIDTNGSLIGINTAAFQVGGEGGGHGINFAI
PIKLAHSIMGKLIKNGRVIRGALGISGEPINPVVAQILNLPDLRGVLVTGIDPNGPAARA
QLLPRDVIIKYDGEDVPGVEMLMDRIAETTPGKKVMMTVIRQGKQQELPVIIDEKVVVSN