Protein Info for SO3933 in Shewanella oneidensis MR-1

Annotation: membrane protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 323 to 343 (21 residues), see Phobius details amino acids 349 to 369 (21 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 319 (312 residues), 73.5 bits, see alignment E=1.6e-24 PF00083: Sugar_tr" amino acids 39 to 149 (111 residues), 23.9 bits, see alignment E=1.9e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_3933)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAG9 at UniProt or InterPro

Protein Sequence (474 amino acids)

>SO3933 membrane protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MANQLRTFASLYSTTLLTVLAGGLLTTYLGLRLSVIHVPQLWIGGMMSAYYVGLVAGSKI
GHRLIAQVGHIRAFVASAGIVAACALGHALVDQLAVWLLLRLIVGMGMMCQYMVLESWLN
EQAESSQRGTVFASYMIVSYFGLILGQGAISLYPELGLEPLLLIAICFALCIVPISLTRR
IHPAPLVPAPLKIAHYWQKAPQALTTIAIGSMIVGSFYGLAPAYASNLGLPPEKVATYMT
ATILAGLLAQWPMGKLSDIMSRSRLIRINCVLLGILALGIALTPYHPTVSLVMTFLFGIL
GFTFYPLATALANSRVEQSERVGLSATILLTFGMGASIGPLIASTLMQWFGNSMLYGFMS
ACTVILFLRLRYVHSQQKAETNVTQDYMMATGDLVSSPLAAALDPRVDVESVQEHMTPTP
QEDQEDLGADTNEDAENDNEHQLTFEFQFDPEPAFIPEVENQVTAHNLDAVKTS