Protein Info for SO3920 in Shewanella oneidensis MR-1

Name: hydA
Annotation: periplasmic Fe hydrogenase, large subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00037: Fer4
  • amino acids 15 to 37 (23 residues), 26.7 bits, see alignment (E = 1.5e-09)
  • amino acids 46 to 68 (23 residues), 27.7 bits, see alignment (E = 6.9e-10)
• TIGR02512: [FeFe] hydrogenase, group A
  • amino acids 15 to 399 (385 residues), 500.5 bits, E=1.4e-154
• PF12838: Fer4_7
  • amino acids 21 to 66 (46 residues), 30.1 bits, 2.2e-10
• PF13187: Fer4_9
  • amino acids 21 to 67 (47 residues), 28.7 bits, 4.3e-10
• PF12837: Fer4_6
  • amino acids 47 to 67 (21 residues), 26.6 bits, see alignment (E = 1.7e-09)
• PF02906: Fe_hyd_lg_C
  • amino acids 87 to 395 (309 residues), 274.9 bits, E=2.7e-85

Best Hits

KEGG orthology group: K00533, ferredoxin hydrogenase large subunit [EC: 1.12.7.2] (inferred from 100% identity to son:SO_3920)

Predicted SEED Role

"Periplasmic [Fe] hydrogenase large subunit (EC 1.12.7.2)" in subsystem Hydrogenases (EC 1.12.7.2)

MetaCyc Pathways

• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• hydrogen production III (1/1 steps found)
• hydrogen production VIII (1/1 steps found)
• hydrogen production VI (1/2 steps found)
• superpathway of hydrogen production (1/2 steps found)
• superpathway of photosynthetic hydrogen production (2/6 steps found)
• L-glutamate degradation VII (to butanoate) (4/12 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.12.7.2

Use Curated BLAST to search for 1.12.7.2

Sequence Analysis Tools

See Q8EAI2 at UniProt or InterPro

Protein Sequence (410 amino acids)

>SO3920 periplasmic Fe hydrogenase, large subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MTTTTYQPGEIQGLIKINASKCKGCDACKQFCPTHAINGASGAVHSIDEDKCLSCGQCLI
NCPFSAIEETHSALETVIKKLADKNTTVVGIIAPAVRVAIGEEFGLGTGELVTGKLYGAM
NQAGFKIFDCNFAADLTIMEEGSEFIHRLHANVKGEANAGPLPQFTSCCPGWVRYLETRY
PALLPNLSTAKSPQQMAGTVAKTYGAKVYQMQPENIFTVSVMPCTSKKLEASRPEFNSAW
QYHQEHGANSPSYQDIDAVLTTREMAQLLKLLDIDLANTAEYQGDSLFSEYTGAGTIFGT
TGGVMEAALRTAHKVLTGTEMAKLEFEPVRGLKGVKSASVSLFDTELNQDVTVNVAVVHD
MGNNIEPVLRDVMAGTSPYHFIEVMNCAGGCVNGGGQPIEGKGSSWLGNI