Protein Info for SO3814 in Shewanella oneidensis MR-1

Annotation: ampG protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 57 to 74 (18 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 270 to 295 (26 residues), see Phobius details amino acids 311 to 329 (19 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 363 to 387 (25 residues), see Phobius details amino acids 399 to 420 (22 residues), see Phobius details amino acids 426 to 447 (22 residues), see Phobius details PF13000: Acatn" amino acids 23 to 219 (197 residues), 34.2 bits, see alignment E=1.1e-12 PF07690: MFS_1" amino acids 25 to 290 (266 residues), 38.7 bits, see alignment E=5.9e-14

Best Hits

KEGG orthology group: K08218, MFS transporter, PAT family, beta-lactamase induction signal transducer AmpG (inferred from 100% identity to son:SO_3814)

Predicted SEED Role

"AmpG permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAS8 at UniProt or InterPro

Protein Sequence (461 amino acids)

>SO3814 ampG protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MFVTGFTRRTLDSLSVYYHKRVLILLLLGFSAGLPLMLVFSTLSFWLREAGVDRTSIGYF
SWIALAYAFKWAWSPLVDRLSIPILTRFLGRRRSWMLFAQLLLVGAILGMSFSDPVKNLE
RLALFALMVAFASATQDIVIDAFRIESAPEKMQAALAAAYQVGYRSAMIVATAGALTIAA
WVEPGNTEYNLIAWQTSYLVMAGLMFIGVLTTLFSREPMVDTRSADKTELAVKQRLSARY
PKPIAASLSWIYTASVLPFIDFFKRYGRSAILILLLISCYRISDIVMGIMANVFYVDMGF
TKEEIAYLSKIYGLIMTLVGAAFGGVLLARFGTMKILFLGALLVAVTNLLFAWQAVIGYN
VSFLTFAISVDNFSAGIATAAFIAYLSSLTSSGYSATQYALLSSIMLLFPKFIAGFSGAY
VDAFGYVNFFVAASVIGFPVLLLIHLVNKYAPHVSAKPDQE