Protein Info for SO3802 in Shewanella oneidensis MR-1

Annotation: ABC transporter, ATP-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF00005: ABC_tran" amino acids 24 to 168 (145 residues), 112.4 bits, see alignment E=2.7e-36 PF13304: AAA_21" amino acids 138 to 197 (60 residues), 32.1 bits, see alignment E=1.2e-11

Best Hits

Swiss-Prot: 71% identical to YADG_ECOLI: Uncharacterized ABC transporter ATP-binding protein YadG (yadG) from Escherichia coli (strain K12)

KEGG orthology group: K09687, antibiotic transport system ATP-binding protein (inferred from 100% identity to son:SO_3802)

Predicted SEED Role

"ABC-type multidrug transport system, ATPase component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAU0 at UniProt or InterPro

Protein Sequence (312 amino acids)

>SO3802 ABC transporter, ATP-binding protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MANHAHALVLEGLKKTYKGGVEAVKGISLTVEQGDFFALLGPNGAGKSTTIGIISSLVQK
TAGSVKVFDFDIDKQLEEAKLCIGLVPQEFNFNQFETVLQIVVNQAGYYGVPKAVALERA
QKYLTQLDLWEKRNSQSRTLSGGMKRRLMIARALMHEPKLLILDEPTAGVDIELRRSMWE
FLKQINQQGVTIILTTHYLEEAEMLCRNIGIIDKGVLVECTSMKALLSKLNLETFILDLR
RDIYVAPTLDGMVCRLTDPHTLEVDVAKEHNLNDVFTQLTAANVEVLSMRNKSNRLEELF
VELVKKTQGAKA