Protein Info for SO3801 in Shewanella oneidensis MR-1

Annotation: ABC transporter, permease protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 104 to 132 (29 residues), see Phobius details amino acids 138 to 163 (26 residues), see Phobius details amino acids 171 to 198 (28 residues), see Phobius details amino acids 218 to 218 (1 residues), see Phobius details amino acids 224 to 248 (25 residues), see Phobius details PF01061: ABC2_membrane" amino acids 9 to 218 (210 residues), 129.8 bits, see alignment E=1.1e-41 PF12698: ABC2_membrane_3" amino acids 57 to 246 (190 residues), 34.6 bits, see alignment E=1.2e-12

Best Hits

Swiss-Prot: 68% identical to YADH_SHIFL: Inner membrane transport permease YadH (yadH) from Shigella flexneri

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to son:SO_3801)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAU1 at UniProt or InterPro

Protein Sequence (256 amino acids)

>SO3801 ABC transporter, permease protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKQLYFIAFKSILTKEINRFTRIWVQTLVPPAITMTLYFLIFGNLVGSRIGEMGGVSYME
FIAPGLIMMSVITNSYSNVASSFYSAKFQRNLEELMVAPVPHYVMIAGYVGGGVARGLCV
GLIVTLVAMFFVDISLHHAGLVVMTVFLTSVLFSLGGLINAVFAKSFDDISIIPTFVLTP
LTYLGGVFYSLSLLPAFWQGVSALNPVVYMINVFRYGFLGFADISVPLSIGIMVGFCAAL
WGVAYYLISRGIGLRS