Protein Info for SO3795 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 42 to 67 (26 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details PF02517: Rce1-like" amino acids 134 to 244 (111 residues), 43.4 bits, see alignment E=1.7e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_3795)

Predicted SEED Role

"FIG01062241: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAU6 at UniProt or InterPro

Protein Sequence (250 amino acids)

>SO3795 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MDVKAFQLGKILFCTGFLGVISIIPFVSTLLGPHSVQLDIPIYLLTLLMVIQSSFMLVLM
VFIGVIFSRKVGLFAPVFAAYAEGGNIYHALKPQFIPALIGGVLGGLFLLCFMEIVVGNL
PQDFIQAGEKLTPPWYAKVVYGGITEEILIRWGLMSFITWCCYRLTQAKETVIQPYNYIF
AIVISAFLFGIGHLPVAFALTSEVNSALIFYIIFGNAGFGFVAGYLYWKRGLECAMLAHI
IAHLIITSFL