Protein Info for SO3749 in Shewanella oneidensis MR-1

Updated annotation (from data): Acetylornithine deacetylase (EC:3.5.1.16)
Rationale: see Deutschbauer et al 2011, PMID:22125499 (auxotroph)
Original annotation: hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04952: AstE_AspA
  • amino acids 66 to 139 (74 residues), 34.9 bits, E=5.2e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_3749)

Predicted SEED Role

"FIG160851: peptidase"

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• superpathway of arginine and polyamine biosynthesis (13/17 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.16

Sequence Analysis Tools

See Q8EAY8 at UniProt or InterPro

Protein Sequence (275 amino acids)

>SO3749 Acetylornithine deacetylase (EC:3.5.1.16) (Shewanella oneidensis MR-1)
MVSRSPFESFQWKSDIFNCESTDIDNFYLQLEQEMSRLGMVEKKLGEVGKYSVSLYQSPA
AKSGLPSLLICAGFHGEESAGPWGLLHFLSEASVELFERVNLSILPLVNPTGFKRGHRFN
KFGENPNRGFEFENGKPKANEGTSVEGKLLLEHAQLLIAASRDGILTCHEDVLSHDAYVY
SFEPSQVPGRFSLDLRDTLAGYFPIAVDGEIDGCPVKDGLIFNHFDTSFEACLVRSGARV
GACTETPALQNFDQRVLANSAAMTHFLALCAPLCD