Protein Info for SO3746 in Shewanella oneidensis MR-1

Name: htrB
Annotation: lipid A biosynthesis lauroyl acyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details TIGR02207: lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase" amino acids 6 to 307 (302 residues), 463 bits, see alignment E=2.4e-143 PF03279: Lip_A_acyltrans" amino acids 6 to 297 (292 residues), 287.7 bits, see alignment E=5e-90

Best Hits

Swiss-Prot: 45% identical to LPXL_HAEIN: Lipid A biosynthesis lauroyltransferase (lpxL) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02517, lipid A biosynthesis lauroyl acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to son:SO_3746)

MetaCyc: 40% identical to lauroyl acyltransferase (Escherichia coli K-12 substr. MG1655)
LAUROYLACYLTRAN-RXN [EC: 2.3.1.241]

Predicted SEED Role

"Lipid A biosynthesis lauroyl acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.241

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EAZ1 at UniProt or InterPro

Protein Sequence (308 amino acids)

>SO3746 lipid A biosynthesis lauroyl acyltransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MVEKAEFSSSLYHPKHWPMWFGVFMMRITQVLPLSWQMKLGKGMGRLVKALAASRTHTAR
CNLALCFPDMPETEREALLTRNFEETGKAIFDTINAWWWSDEKIQQHMQITGKEYVQDTL
NAGHGVILFAVHCLPLEMGARIFGQFQPGVGVYRPHNNPVMEYLQVKGRLRSNKALVPKR
DLRQMVRCLRNPDVIWYTADQDFGRSSAVFIPFYAVPDAATITGATTLAKLGKAKVLPFF
VERTEGDTGYRIEIMPPLDNFPGEDEVADAIRGNKIIEEIINRNRAQYMWLHRRFKTRPD
PTDKSLYK