Protein Info for SO3728 in Shewanella oneidensis MR-1

Name: cobA
Annotation: uroporphyrin-III C-methyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 TIGR01469: uroporphyrinogen-III C-methyltransferase" amino acids 13 to 248 (236 residues), 311.7 bits, see alignment E=1.8e-97 PF00590: TP_methylase" amino acids 14 to 224 (211 residues), 171.3 bits, see alignment E=1.4e-54

Best Hits

KEGG orthology group: K02303, uroporphyrin-III C-methyltransferase [EC: 2.1.1.107] (inferred from 100% identity to son:SO_3728)

Predicted SEED Role

"Uroporphyrinogen-III methyltransferase (EC 2.1.1.107)" in subsystem Coenzyme B12 biosynthesis or Dissimilatory nitrite reductase or Experimental tye or Heme and Siroheme Biosynthesis (EC 2.1.1.107)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.107

Use Curated BLAST to search for 2.1.1.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EB08 at UniProt or InterPro

Protein Sequence (276 amino acids)

>SO3728 uroporphyrin-III C-methyltransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MEILSLPGQSAKGKVWLVGAGPGDVELLTLKAWRILKSADAVLYDALVSQDILDLIPKDA
EKIAVGKRAGKHSAAQDDINQLLVTKAYTRKNVVRLKGGDPFIFGRGGEELQTLVDAGVE
FEVVPGITAASGTAAYTGIPLTHRDYAQGVTFITGHCQLESRPMDWQGYANPNNTLVVYM
GILNAGVIRAGLINAGRSPQTPVAIVSKATTQSQQRFIGQLDSLEQLAADPKLQMPALMI
IGEVVGLSETLNWFQPKAEGSQSLEALNAPKVAVKI