Protein Info for SO3720 in Shewanella oneidensis MR-1
Annotation: conserved hypothetical protein (NCBI ptt file)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00230, protoporphyrinogen oxidase [EC: 1.3.3.4] (inferred from 100% identity to son:SO_3720)Predicted SEED Role
"Protoporphyrinogen IX oxidase, oxygen-independent, HemG (EC 1.3.-.-)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.-.-)
MetaCyc Pathways
- superpathway of heme b biosynthesis from glutamate (10/10 steps found)
- superpathway of heme b biosynthesis from glycine (7/8 steps found)
- heme b biosynthesis I (aerobic) (4/4 steps found)
- 3,8-divinyl-chlorophyllide a biosynthesis I (aerobic, light-dependent) (3/9 steps found)
- 3,8-divinyl-chlorophyllide a biosynthesis III (aerobic, light independent) (3/9 steps found)
KEGG Metabolic Maps
- 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
- Biosynthesis of alkaloids derived from shikimate pathway
- Limonene and pinene degradation
- Porphyrin and chlorophyll metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.3.-.-, 1.3.3.4
Use Curated BLAST to search for 1.3.-.- or 1.3.3.4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8EB16 at UniProt or InterPro
Protein Sequence (141 amino acids)
>SO3720 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1) MVIADIKAVPAMESFDKIIIGASIRHGKHNPALYEFIQKHQQILTQKVSGFFSVSLVARK PEKNTPETNPYMQAFLSKTTWRPKLLQVFGGNLNYQGYNAFDRNIIRFIMWLTKGPTDPV TNVEYTDWQKVQEFGLQIHQA