Protein Info for SO3602 in Shewanella oneidensis MR-1

Name: cysA-1
Annotation: sulfate ABC transporter, ATP-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 TIGR00968: sulfate ABC transporter, ATP-binding protein" amino acids 3 to 242 (240 residues), 386.5 bits, see alignment E=2.3e-120 PF00005: ABC_tran" amino acids 19 to 164 (146 residues), 133.8 bits, see alignment E=1e-42 PF12857: TOBE_3" amino acids 287 to 346 (60 residues), 56.9 bits, see alignment E=2.3e-19

Best Hits

Swiss-Prot: 100% identical to CYSA1_SHEON: Sulfate/thiosulfate import ATP-binding protein CysA 1 (cysA1) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02045, sulfate transport system ATP-binding protein [EC: 3.6.3.25] (inferred from 100% identity to son:SO_3602)

Predicted SEED Role

"Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)" in subsystem Cysteine Biosynthesis (EC 3.6.3.25)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.25

Use Curated BLAST to search for 3.6.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBC3 at UniProt or InterPro

Protein Sequence (376 amino acids)

>SO3602 sulfate ABC transporter, ATP-binding protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MSIRLTNISKKFGQFQALSPLNLDIQEGEMIGLLGPSGSGKTTLLRIIAGLEGADSGHIH
FGNRDVTQVHVRDRRVGFVFQNYALFRHMTVADNVAFGLEVIPKKQRPSAAEIQKRVSHL
LEMVQLGHLAQRYPEQLSGGQKQRIALARALATQPEVLLLDEPFGALDAKVRKELRRWLR
SLHDELKFTSVFVTHDQDEALELSDRVVVMSNGNIEQVNTPIELYAQPNSRFVFDFLGNV
NRFEANWQQNRWTNGDAFIVPPEQTPLQQNGALYVRSHELALADKPNSQAHIPFTIVAIT
PIGAEVRVELAPIGWQSEELWEAKFTHHHLQELGLQKGSVVYATPRTGYFFGKQGDGSPI
RQSWPFLPPGSLAFDI