Protein Info for SO3556 in Shewanella oneidensis MR-1

Annotation: cyclic nucleotide phosphodiesterase, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details PF13185: GAF_2" amino acids 100 to 248 (149 residues), 41.6 bits, see alignment E=2.3e-14 PF01590: GAF" amino acids 161 to 248 (88 residues), 31.3 bits, see alignment E=4.1e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 259 to 407 (149 residues), 97 bits, see alignment E=5.1e-32 PF00990: GGDEF" amino acids 261 to 403 (143 residues), 98.2 bits, see alignment E=6.5e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_3556)

Predicted SEED Role

"GGDEF domain/HAMP domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBG2 at UniProt or InterPro

Protein Sequence (420 amino acids)

>SO3556 cyclic nucleotide phosphodiesterase, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MKLRDNFKRKTIDRLDYRYHLLLLIIPIVLFVLLFVFNAPTEGWTILPLLFVCLIYVVTY
SLIYYLHQGRLTRLWQHLEQVVSINDAIYELAHLSSQYKNEHAFLDALLNKAVCIINGAE
MGSIIKVSEDNHKLHFESVVGLDLNKLKRLNFSLEQSFEYRLTKGKCDRVVVVDDMKNIN
AASTLTNEQQQVLLTAAKQPIRSTLSSPIRIDGKLYGMLNLDSSSVGAFNDYDRNLVSIL
THEASNAIALYQKSLQITKLANFDNLTGLYNRKNFEDALQHWQPKAHLGSFLVIIDMDNL
KIINDQQGHQVGDVAIKEVAKTILGFWKHKGIISRFGGDEFVALCHGPLELIENDLDAMR
LKLHHESPLNLNFSVGIAPYDNDWAKSFKQADNAMYEQKRGKKQAVNALKAIVANNQLPQ