Protein Info for SO3537 in Shewanella oneidensis MR-1

Name: rpsT
Annotation: ribosomal protein S20 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 88 TIGR00029: ribosomal protein bS20" amino acids 1 to 85 (85 residues), 107.4 bits, see alignment E=2.1e-35 PF01649: Ribosomal_S20p" amino acids 2 to 84 (83 residues), 103.5 bits, see alignment E=3.9e-34

Best Hits

Swiss-Prot: 100% identical to RS20_SHEON: 30S ribosomal protein S20 (rpsT) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02968, small subunit ribosomal protein S20 (inferred from 98% identity to shn:Shewana3_3140)

MetaCyc: 72% identical to 30S ribosomal subunit protein S20 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S20p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBH9 at UniProt or InterPro

Protein Sequence (88 amino acids)

>SO3537 ribosomal protein S20 (NCBI ptt file) (Shewanella oneidensis MR-1)
MANSKSAKKRALQSEKRRQHNASRRSMLRTYVKKVIAAIRAGDHKTATEAFAAAQPIVDR
MATKGLIHKNKAARHKARLNAKIKALVA