Protein Info for SO3503 in Shewanella oneidensis MR-1

Updated annotation (from data): N-acetyl glucosamine transporter, NagP
Rationale: Specific phenotype on NAG. Also see PMID:16857666 (SEED_correct)
Original annotation: glucose/galactose transporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 238 to 262 (25 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details amino acids 343 to 365 (23 residues), see Phobius details amino acids 377 to 396 (20 residues), see Phobius details amino acids 407 to 424 (18 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 391 (373 residues), 80.6 bits, see alignment E=5.5e-27 TIGR01272: glucose/galactose transporter WARNING" amino acids 95 to 422 (328 residues), 216 bits, see alignment E=4.6e-68

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_3503)

Predicted SEED Role

"N-acetyl glucosamine transporter, NagP" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EBL0 at UniProt or InterPro

Protein Sequence (435 amino acids)

>SO3503 N-acetyl glucosamine transporter, NagP (Shewanella oneidensis MR-1)
MTLDKSQQKSSFLPMAIVAALFFILGFATWLNGSLMPYLKQILQLNPFQASLILFSFYIA
VTFTALPSAWVIRKVGYKNGMALGMGVMMIAGLLFIPAAKTQVFALFLFAQLVMGAGQTL
LQTAVNPYVVRLGPEESAAARVSVMGILNKGAGVIAPLVFSALILDSFKDRIGTTLTQVQ
IDEMANGLVLPYLGMAVFIGILALAVKKSPLPELSNEDEVADHTDKSQIKAALSHPNLAL
GVLALFVYVAVEVIAGDTIGTFALSLGIDHYGVMTSYTMVCMVLGYILGILLIPRVISQP
TALMISAILGLLLTLGILFGDNNSYAIANLLLVPFGGVALPDTLLLIAFLGLANAIVWPA
VWPLALSGMGKLTSTGSALLIMGIAGGAFGPVSWGLMSSATDMGQQGGYMVMLPCYLFIL
FYAVKGHKMRSWSAK